RegulonDB RegulonDB 10.9: Amino acid Sequence
poly(A) polymerase I Amino Acid Sequence


Size: 465

Fasta

 

>poly(A) polymerase I E. coli K12. Version NC_000913.3 GI:556503834
MFTRVANFCRKVLSREESEAEQAVARPQVTVIPREQHAISRKDISENALKVMYRLNKAGY
EAWLVGGGVRDLLLGKKPKDFDVTTNATPEQVRKLFRNCRLVGRRFRLAHVMFGPEIIEV
ATFRGHHEGNVSDRTTSQRGQNGMLLRDNIFGSIEEDAQRRDFTINSLYYSVADFTVRDY
VGGMKDLKDGVIRLIGNPETRYREDPVRMLRAVRFAAKLGMRISPETAEPIPRLATLLND
IPPARLFEESLKLLQAGYGYETYKLLCEYHLFQPLFPTITRYFTENGDSPMERIIEQVLK
NTDTRIHNDMRVNPAFLFAAMFWYPLLETAQKIAQESGLTYHDAFALAMNDVLDEACRSL
AIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLLEHPKFRAAYDLLALRAEVERNAELQRLV
KWWGEFQVSAPPDQKGMLNELDEEPSPRRRTRRPRKRAPRREGTA
              
                            

Download fasta file
RegulonDB