RegulonDB RegulonDB 10.10: Amino acid Sequence
CDP-diacylglycerol—glycerol-3-phosphate 3-phosphatidyltransferase Amino Acid Sequence


Size: 182

Fasta

 

>CDP-diacylglycerol—glycerol-3-phosphate 3-phosphatidyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MQFNIPTLLTLFRVILIPFFVLVFYLPVTWSPFAAALIFCVAAVTDWFDGFLARRWNQST
RFGAFLDPVADKVLVAIAMVLVTEHYHSWWVTLPAATMIAREIIISALREWMAELGKRSS
VAVSWIGKVKTTAQMVALAWLLWRPNIWVEYAGIALFFVAAVLTLWSMLQYLSAARADLL
DQ
              
                            

Download fasta file
RegulonDB