RegulonDB RegulonDB 10.9: Amino acid Sequence
phenylalanine—tRNA ligase subunit α Amino Acid Sequence


Size: 327

Fasta

 

>phenylalanine—tRNA ligase subunit α E. coli K12. Version NC_000913.3 GI:556503834
MSHLAELVASAKAAISQASDVAALDNVRVEYLGKKGHLTLQMTTLRELPPEERPAAGAVI
NEAKEQVQQALNARKAELESAALNARLAAETIDVSLPGRRIENGGLHPVTRTIDRIESFF
GELGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDTTRLLRTQTSGVQIRTMKA
QQPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLQ
IRFRPSYFPFTEPSAEVDVMGKNGKWLEVLGCGMVHPNVLRNVGIDPEVYSGFAFGMGME
RLTMLRYGVTDLRSFFENDLRFLKQFK
              
                            

Download fasta file
RegulonDB