RegulonDB RegulonDB 10.9: Amino acid Sequence
sensory histidine kinase CreC Amino Acid Sequence


Size: 474

Fasta

 

>sensory histidine kinase CreC E. coli K12. Version NC_000913.3 GI:556503834
MRIGMRLLLGYFLLVAVAAWFVLAIFVKEVKPGVRRATEGTLIDTATLLAELARPDLLSG
DPTHGQLAQAFNQLQHRPFRANIGGINKVRNEYHVYMTDAQGKVLFDSANKAVGQDYSRW
NDVWLTLRGQYGARSTLQNPADPESSVMYVAAPIMDGSRLIGVLSVGKPNAAMAPVIKRS
ERRILWASAILLGIALVIGAGMVWWINRSIARLTRYADSVTDNKPVPLPDLGSSELRKLA
QALESMRVKLEGKNYIEQYVYALTHELKSPLAAIRGAAEILREGPPPEVVARFTDNILTQ
NARMQALVETLLRQARLENRQEVVLTAVDVAALFRRVSEARTVQLAEKKITLHVTPTEVN
VAAEPALLEQALGNLLDNAIDFTPESGCITLSAEVDQEHVTLKVLDTGSGIPDYALSRIF
ERFYSLPRANGQKSSGLGLAFVSEVARLFNGEVTLRNVQEGGVLASLRLHRHFT
              
                            

Download fasta file
RegulonDB