RegulonDB RegulonDB 10.9: Amino acid Sequence
sensor histidine kinase PhoR Amino Acid Sequence


Size: 431

Fasta

 

>sensory histidine kinase PhoR E. coli K12. Version NC_000913.3 GI:556503834
MLERLSWKRLVLELLLCCLPAFILGAFFGYLPWFLLASVTGLLIWHFWNLLRLSWWLWVD
RSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGAESLPDAVVLTTEEGGI
FWCNGLAQQILGLRWPEDNGQNILNLLRYPEFTQYLKTRDFSRPLNLVLNTGRHLEIRVM
PYTHKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVLQGYLEMMNEQPLEGAVRE
KALHTMREQTQRMEGLVKQLLTLSKIEAAPTHLLNEKVDVPMMLRVVEREAQTLSQKKQT
FTFEIDNGLKVSGNEDQLRSAISNLVYNAVNHTPEGTHITVRWQRVPHGAEFSVEDNGPG
IAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVNHHESRLNIESTVGKGTRFSFV
IPERLIAKNSD
              
                            

Download fasta file
RegulonDB