RegulonDB RegulonDB 10.9: Amino acid Sequence
pyridine nucleotide transhydrogenase subunit β Amino Acid Sequence


Size: 462

Fasta

 

>pyridine nucleotide transhydrogenase subunit β E. coli K12. Version NC_000913.3 GI:556503834
MSGGLVTAAYIVAAILFIFSLAGLSKHETSRQGNNFGIAGMAIALIATIFGPDTGNVGWI
LLAMVIGGAIGIRLAKKVEMTEMPELVAILHSFVGLAAVLVGFNSYLHHDAGMAPILVNI
HLTEVFLGIFIGAVTFTGSVVAFGKLCGKISSKPLMLPNRHKMNLAALVVSFLLLIVFVR
TDSVGLQVLALLIMTAIALVFGWHLVASIGGADMPVVVSMLNSYSGWAAAAAGFMLSNDL
LIVTGALVGSSGAILSYIMCKAMNRSFISVIAGGFGTDGSSTGDDQEVGEHREITAEETA
ELLKNSHSVIITPGYGMAVAQAQYPVAEITEKLRARGINVRFGIHPVAGRLPGHMNVLLA
EAKVPYDIVLEMDEINDDFADTDTVLVIGANDTVNPAAQDDPKSPIAGMPVLEVWKAQNV
IVFKRSMNTGYAGVQNPLFFKENTHMLFGDAKASVDAILKAL
              
                            

Download fasta file
RegulonDB