RegulonDB RegulonDB 10.9: Amino acid Sequence
glycine betaine ABC transporter membrane subunit ProW Amino Acid Sequence


Size: 354

Fasta

 

>glycine betaine ABC transporter membrane subunit ProW E. coli K12. Version NC_000913.3 GI:556503834
MADQNNPWDTTPAADSAAQSADAWGTPTTAPTDGGGADWLTSTPAPNVEHFNILDPFHKT
LIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVFALIAWQI
SGVGMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLARSPRAAKII
RPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQVPADLIEA
SRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGR
LDMGLATVGGVGIVILAIILDRLTQAVGRDSRSRGNRRWYTTGPVGLLTRPFIK
              
                            

Download fasta file
RegulonDB