RegulonDB RegulonDB 11.1: Amino acid Sequence
ribose-phosphate diphosphokinase Amino Acid Sequence


Size: 315

Fasta

 

>ribose-phosphate diphosphokinase E. coli K12. Version NC_000913.3 GI:556503834
MPDMKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTC
APTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSV
GVDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQLNLDNPIVVSPDIGGVVRARAI
AKLLNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERG
AKRVFAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLSDEIKSLPNVRTLTLSGMLAEAI
RRISNEESISAMFEH
              
                            

Download fasta file
RegulonDB