RegulonDB RegulonDB 10.10: Amino acid Sequence
phage shock protein C Amino Acid Sequence


Size: 119

Fasta

 

>phage shock protein C E. coli K12. Version NC_000913.3 GI:556503834
MAGINLNKKLWRIPQQGMVRGVCAGIANYFDVPVKLVRILVVLSIFFGLALFTLVAYIIL
SFALDPMPDNMAFGEQLPSSSELLDEVDRELAASETRLREMERYVTSDTFTLRSRFRQL
              
                            

Download fasta file
RegulonDB