RegulonDB RegulonDB 10.9: Amino acid Sequence
peptidyl-tRNA hydrolase Amino Acid Sequence


Size: 194

Fasta

 

>peptidyl-tRNA hydrolase E. coli K12. Version NC_000913.3 GI:556503834
MTIKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVR
LLVPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDI
ISKLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTEMWFTDG
LTKATNRLHAFKAQ
              
                            

Download fasta file
RegulonDB