RegulonDB RegulonDB 10.9: Amino acid Sequence
N5-carboxyaminoimidazole ribonucleotide mutase Amino Acid Sequence


Size: 169

Fasta

 

>N5-carboxyaminoimidazole ribonucleotide mutase E. coli K12. Version NC_000913.3 GI:556503834
MSSRNNPARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEE
NGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLA
IGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRGAA
              
                            

Download fasta file
RegulonDB