RegulonDB RegulonDB 10.9: Amino acid Sequence
bifunctional AICAR transformylase/IMP cyclohydrolase Amino Acid Sequence


Size: 529

Fasta

 

>bifunctional AICAR transformylase/IMP cyclohydrolase E. coli K12. Version NC_000913.3 GI:556503834
MQQRRPVRRALLSVSDKAGIVEFAQALSARGVELLSTGGTARLLAEKGLPVTEVSDYTGF
PEMMDGRVKTLHPKVHGGILGRRGQDDAIMEEHQIQPIDMVVVNLYPFAQTVAREGCSLE
DAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDYDAIIKEMDDNEGSLTLATRFDLAIKAF
EHTAAYDSMIANYFGSMVPAYHGESKEAAGRFPRTLNLNFIKKLDMRYGENSHQQAAFYI
EENVKEASVATATQVQGKALSYNNIADTDAALECVKEFAEPACVIVKHANPCGVAIGNSI
LDAYDRAYKTDPTSAFGGIIAFNRELDAETAQAIISRQFVEVIIAPSASEEALKITAAKQ
NVRVLTCGQWGERVPGLDFKRVNGGLLVQDRDLGMVGAEELRVVTKRQPSEQELRDALFC
WKVAKFVKSNAIVYAKNNMTIGIGAGQMSRVYSAKIAGIKAADEGLEVKGSSMASDAFFP
FRDGIDAAAAAGVTCVIQPGGSIRDDEVIAAADEHGIAMLFTDMRHFRH
              
                            

Download fasta file
RegulonDB