RegulonDB RegulonDB 10.9: Amino acid Sequence
DNA repair protein RecR Amino Acid Sequence


Size: 201

Fasta

 

>DNA repair protein RecR E. coli K12. Version NC_000913.3 GI:556503834
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIRF
              
                            

Download fasta file
RegulonDB