RegulonDB RegulonDB 10.9: Amino acid Sequence
Qin prophage; antitoxin/DNA-binding transcriptional repressor RelB Amino Acid Sequence


Size: 79

Fasta

 

>Qin prophage; antitoxin/DNA-binding transcriptional repressor RelB E. coli K12. Version NC_000913.3 GI:556503834
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVE
IVKERLRNPKPVRVTLDEL
              
                            

Download fasta file
RegulonDB