RegulonDB RegulonDB 10.9: Amino acid Sequence
protein RhsD Amino Acid Sequence


Size: 1426

Fasta

 

>protein RhsD E. coli K12. Version NC_000913.3 GI:556503834
MSGKPAARQGDMTQYGGPIVQGSAGVRIGAPTGVACSVCPGGMTSGNPVNPLLGAKVLPG
ETDLALPGPLPFILSRTYSSYRTKTPAPVGVFGPGWKAPSDIRLQLRDDGLILNDNGGRS
IHFEPLLPGEAVYSRSESMWLVRGGKAAQPDGHTLARLWGALPPDIRLSPHLYLATNSAQ
GPWWILGWSERVPGAEDVLPAPLPPYRVLTGMADRFGRTLTYRREAAGDLAGEITGVTDG
AGREFRLVLTTQAQRAEEARTSSLSSSDSSRPLSASAFPDTLPGTEYGPDRGIRLSAVWL
MHDPAYPESLPAAPLVRYTYTEAGELLAVYDRSNTQVRAFTYDAQHPGRMVAHRYAGRPE
MRYRYDDTGRVVEQLNPAGLSYRYLYEQDRITVTDSLNRREVLHTEGGAGLKRVVKKELA
DGSVTRSGYDAAGRLTAQTDAAGRRTEYGLNVVSGDITDITTPDGRETKFYYNDGNQLTA
VVSPDGLESRREYDEPGRLVSETSRSGETVRYRYDDAHSELPATTTDATGSTRQMTWSRY
GQLLAFTDCSGYQTRYEYDRFGQMTAVHREEGISLYRRYDNRGRLTSVKDAQGRETRYEY
NAAGDLTAVITPDGNRSETQYDAWGKAVSTTQGGLTRSMEYDAAGRVISLTNENGSHSVF
SYDALDRLVQQGGFDGRTQRYHYDLTGKLTQSEDEGLVILWYYDESDRITHRTVNGEPAE
QWQYDGHGWLTDISHLSEGHRVAVHYGYDDKGRLTGECQTVENPETGELLWQHETKHAYN
EQGLANRVTPDSLPPVEWLTYGSGYLAGMKLGGTPLVEYTRDRLHRETVRSFGSMAGSNA
AYELTSTYTPAGQLQSQHLNSLVYDRDYGWSDNGDLVRISGPRQTREYGYSATGRLESVR
TLAPDLDIRIPYATDPAGNRLPDPELHPDSTLTVWPDNRIAEDAHYVYRHDEYGRLTEKT
DRIPAGVIRTDDERTHHYHYDSQHRLVFYTRIQHGEPLVESRYLYDPLGRRMAKRVWRRE
RDLTGWMSLSRKPEVTWYGWDGDRLTTVQTDTTRIQTVYEPGSFTPLIRVETENGEREKA
QRRSLAETLQQEGSENGHGVVFPAELVRLLDRLEEEIRADRVSSESRAWLAQCGLTVEQL
ARQVEPEYTPARKAHLYHCDHRGLPLALISEDGNTAWSAEYDEWGNQLNEENPHHVYQPY
RLPGQQHDEESGLYYNRHRYYDPLQGRYITQDPMGLKGGWNLYQYPLNPLQQIDPMGLLQ
TWDDARSGACTGGVCGVLSRIIGPSKFDSTADAALDALKETQNRSLCNDMEYSGIVCKDT
NGKYFASKAETDNLRKESYPLKRKCPTGTDRVAAYHTHGADSHGDYVDEFFSSSDKNLVR
SKDNNLEAFYLATPDGRFEALNNKGEYIFIRNSVPGLSSVCIPYHD
              
                            

Download fasta file
RegulonDB