RegulonDB RegulonDB 11.1: Amino acid Sequence
rare lipoprotein RlpA Amino Acid Sequence


Size: 362

Fasta

 

>rare lipoprotein RlpA E. coli K12. Version NC_000913.3 GI:556503834
MRKQWLGICIAAGMLAACTSDDGQQQTVSVPQPAVCNGPIVEISGADPRFEPLNATANQD
YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR
ITNLANGRMIVVRINDRGPYGNDRVISLSRAAADRLNTSNNTKVRIDPIIVAQDGSLSGP
GMACTTVAKQTYALPAPPDLSGGAGTSSVSGPQGDILPVSNSTLKSEDPTGAPVTSSGFL
GAPTTLAPGVLEGSEPTPAPQPVVTAPSTTPATSPAMVTPQAVSQSASGNFMVQVGAVSD
QARAQQYQQQLGQKFGVPGRVTQNGAVWRIQLGPFASKAEASTLQQRLQTEAQLQSFITT
AQ
              
                            

Download fasta file
RegulonDB