RegulonDB RegulonDB 10.9: Amino acid Sequence
lipopolysaccharide assembly protein LptE Amino Acid Sequence


Size: 193

Fasta

 

>lipopolysaccharide assembly protein LptE E. coli K12. Version NC_000913.3 GI:556503834
MRYLATLLLSLAVLITAGCGWHLRDTTQVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGV
ELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISA
KVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKLPSIRAADIRSDEEQTSTTTDT
PATPARVSTTLGN
              
                            

Download fasta file
RegulonDB