RegulonDB RegulonDB 10.10: Amino acid Sequence
RNase HII Amino Acid Sequence


Size: 198

Fasta

 

>RNase HII E. coli K12. Version NC_000913.3 GI:556503834
MIEFVYPHTQLVAGVDEVGRGPLVGAVVTAAVILDPARPIAGLNDSKKLSEKRRLALYEE
IKEKALSWSLGRAEPHEIDELNILHATMLAMQRAVAGLHIAPEYVLIDGNRCPKLPMPAM
AVVKGDSRVPEISAASILAKVTRDAEMAALDIVFPQYGFAQHKGYPTAFHLEKLAEHGAT
EHHRRSFGPVKRALGLAS
              
                            

Download fasta file
RegulonDB