RegulonDB RegulonDB 10.9: Amino acid Sequence
30S ribosomal subunit protein S11 Amino Acid Sequence


Size: 129

Fasta

 

>30S ribosomal subunit protein S11 E. coli K12. Version NC_000913.3 GI:556503834
MAKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP
FAAQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG
CRPPKKRRV
              
                            

Download fasta file
RegulonDB