RegulonDB RegulonDB 10.10: Amino acid Sequence
ATP-dependent structure-specific DNA nuclease - SbcC subunit Amino Acid Sequence


Size: 1048

Fasta

 

>ATP dependent, structure specific DNA nuclease - SbcC subunit E. coli K12. Version NC_000913.3 GI:556503834
MKILSLRLKNLNSLKGEWKIDFTREPFASNGLFAITGPTGAGKTTLLDAICLALYHETPR
LSNVSQSQNDLMTRDTAECLAEVEFEVKGEAYRAFWSQNRARNQPDGNLQVPRVELARCA
DGKILADKVKDKLELTATLTGLDYGRFTRSMLLSQGQFAAFLNAKPKERAELLEELTGTE
IYGQISAMVFEQHKSARTELEKLQAQASGVTLLTPEQVQSLTASLQVLTDEEKQLITAQQ
QEQQSLNWLTRQDELQQEASRRQQALQQALAEEEKAQPQLAALSLAQPARNLRPHWERIA
EHSAALAHIRQQIEEVNTRLQSTMALRASIRHHAAKQSAELQQQQQSLNTWLQEHDRFRQ
WNNEPAGWRAQFSQQTSDREHLRQWQQQLTHAEQKLNALAAITLTLTADEVATALAQHAE
QRPLRQHLVALHGQIVPQQKRLAQLQVAIQNVTQEQTQRNAALNEMRQRYKEKTQQLADV
KTICEQEARIKTLEAQRAQLQAGQPCPLCGSTSHPAVEAYQALEPGVNQSRLLALENEVK
KLGEEGATLRGQLDAITKQLQRDENEAQSLRQDEQALTQQWQAVTASLNITLQPLDDIQP
WLDAQDEHERQLRLLSQRHELQGQIAAHNQQIIQYQQQIEQRQQLLLTTLTGYALTLPQE
DEEESWLATRQQEAQSWQQRQNELTALQNRIQQLTPILETLPQSDELPHCEETVVLENWR
QVHEQCLALHSQQQTLQQQDVLAAQSLQKAQAQFDTALQASVFDDQQAFLAALMDEQTLT
QLEQLKQNLENQRRQAQTLVTQTAETLAQHQQHRPDDGLALTVTVEQIQQELAQTHQKLR
ENTTSQGEIRQQLKQDADNRQQQQTLMQQIAQMTQQVEDWGYLNSLIGSKEGDKFRKFAQ
GLTLDNLVHLANQQLTRLHGRYLLQRKASEALEVEVVDTWQADAVRDTRTLSGGESFLVS
LALALALSDLVSHKTRIDSLFLDEGFGTLDSETLDTALDALDALNASGKTIGVISHVEAM
KERIPVQIKVKKINGLGYSKLESTFAVK
              
                            

Download fasta file
RegulonDB