RegulonDB RegulonDB 10.9: Amino acid Sequence
superoxide dismutase (Fe) Amino Acid Sequence


Size: 193

Fasta

 

>superoxide dismutase (Fe) E. coli K12. Version NC_000913.3 GI:556503834
MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSS
EGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFG
SGWTWLVKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLEHFWA
LVNWEFVAKNLAA
              
                            

Download fasta file
RegulonDB