RegulonDB RegulonDB 10.10: Amino acid Sequence
S-adenosylmethionine decarboxylase proenzyme Amino Acid Sequence


Size: 264

Fasta

 

>S-adenosylmethionine decarboxylase proenzyme E. coli K12. Version NC_000913.3 GI:556503834
MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANRLTEILSETCSIIG
ANILNIARQDYEPQGASVTILVSEEPVDPKLIDKTEHPGPLPETVVAHLDKSHICVHTYP
ESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTIDYRVRGFTRDINGMKHF
IDHEINSIQNFMSDDMKALYDMVDVNVYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSE
RQEITAALWKEMREIYYGRNMPAV
              
                            

Download fasta file
RegulonDB