RegulonDB RegulonDB 10.9: Amino acid Sequence
protease IV, a signal peptide peptidase Amino Acid Sequence


Size: 618

Fasta

 

>protease IV, a signal peptide peptidase E. coli K12. Version NC_000913.3 GI:556503834
MRTLWRFIAGFFKWTWRLLNFVREMVLNLFFIFLVLVGVGIWMQVSGGDSKETASRGALL
LDISGVIVDKPDSSQRFSKLSRQLLGASSDRLQENSLFDIVNTIRQAKDDRNITGIVMDL
KNFAGGDQPSMQYIGKALKEFRDSGKPVYAVGENYSQGQYYLASFANKIWLSPQGVVDLH
GFATNGLYYKSLLDKLKVSTHVFRVGTYKSAVEPFIRDDMSPAAREADSRWIGELWQNYL
NTVAANRQIPAEQVFPGAQGLLEGLTKTGGDTAKYALENKLVDALASSAEIEKALTKEFG
WSKTDKNYRAISYYDYALKTPADTGDSIGVVFANGAIMDGEETQGNVGGDTTAAQIRDAR
LDPKVKAIVLRVNSPGGSVTASEVIRAELAAARAAGKPVVVSMGGMAASGGYWISTPANY
IVANPSTLTGSIGIFGVITTVENSLDSIGVHTDGVSTSPLADVSITRALPPEAQLMMQLS
IENGYKRFITLVADARHSTPEQIDKIAQGHVWTGQDAKANGLVDSLGDFDDAVAKAAELA
KVKQWHLEYYVDEPTFFDKVMDNMSGSVRAMLPDAFQAMLPAPLASVASTVKSESDKLAA
FNDPQNRYAFCLTCANMR
              
                            

Download fasta file
RegulonDB