RegulonDB RegulonDB 10.9: Amino acid Sequence
sorbitol-specific PTS enzyme IIA component Amino Acid Sequence


Size: 123

Fasta

 

>sorbitol-specific PTS enzyme IIA component E. coli K12. Version NC_000913.3 GI:556503834
MTVIYQTTITRIGASAIDALSDQMLITFREGAPADLEEYCFIHCHGELKGALHPGLQFSL
GQHRYPVTAVGSVAEDNLRELGHVTLRFDGLNEAEFPGTVHVAGPVPDDIAPGSVLKFES
VKE
              
                            

Download fasta file
RegulonDB