RegulonDB RegulonDB 10.9: Amino acid Sequence
sorbitol-6-phosphate 2-dehydrogenase Amino Acid Sequence


Size: 259

Fasta

 

>sorbitol-6-phosphate 2-dehydrogenase E. coli K12. Version NC_000913.3 GI:556503834
MNQVAVVIGGGQTLGAFLCHGLAAEGYRVAVVDIQSDKAANVAQEINAEYGESMAYGFGA
DATSEQSVLALSRGVDEIFGRVDLLVYSAGIAKAAFISDFQLGDFDRSLQVNLVGYFLCA
REFSRLMIRDGIQGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITVH
SLMLGNLLKSPMFQSLLPQYATKLGIKPDQVEQYYIDKVPLKRGCDYQDVLNMLLFYASP
KASYCTGQSINVTGGQVMF
              
                            

Download fasta file
RegulonDB