RegulonDB RegulonDB 10.9: Amino acid Sequence
D-arabinose 5-phosphate isomerase GutQ Amino Acid Sequence


Size: 321

Fasta

 

>D-arabinose 5-phosphate isomerase GutQ E. coli K12. Version NC_000913.3 GI:556503834
MSEALLNAGRQTLMLELQEASRLPERLGDDFVRAANIILHCEGKVVVSGIGKSGHIGKKI
AATLASTGTPAFFVHPAEALHGDLGMIESRDVMLFISYSGGAKELDLIIPRLEDKSIALL
AMTGKPTSPLGLAAKAVLDISVEREACPMHLAPTSSTVNTLMMGDALAMAVMQARGFNEE
DFARSHPAGALGARLLNKVHHLMRRDDAIPQVALTASVMDAMLELSRTGLGLVAVCDAQQ
QVQGVFTDGDLRRWLVGGGALTTPVNEAMTVGGTTLQSQSRAIDAKEILMKRKITAAPVV
DENGKLTGAINLQDFYQAGII
              
                            

Download fasta file
RegulonDB