RegulonDB RegulonDB 10.9: Amino acid Sequence
ATP-dependent RNA helicase SrmB Amino Acid Sequence


Size: 444

Fasta

 

>ATP-dependent RNA helicase SrmB E. coli K12. Version NC_000913.3 GI:556503834
MTVTTFSELELDESLLEALQDKGFTRPTAIQAAAIPPALDGRDVLGSAPTGTGKTAAYLL
PALQHLLDFPRKKSGPPRILILTPTRELAMQVSDHARELAKHTHLDIATITGGVAYMNHA
EVFSENQDIVVATTGRLLQYIKEENFDCRAVETLILDEADRMLDMGFAQDIEHIAGETRW
RKQTLLFSATLEGDAIQDFAERLLEDPVEVSANPSTRERKKIHQWYYRADDLEHKTALLV
HLLKQPEATRSIVFVRKRERVHELANWLREAGINNCYLEGEMVQGKRNEAIKRLTEGRVN
VLVATDVAARGIDIPDVSHVFNFDMPRSGDTYLHRIGRTARAGRKGTAISLVEAHDHLLL
GKVGRYIEEPIKARVIDELRPKTRAPSEKQTGKPSKKVLAKRAEKKKAKEKEKPRVKKRH
RDTKNIGKRRKPSGTGVPPQTTEE
              
                            

Download fasta file
RegulonDB