RegulonDB RegulonDB 10.10: Amino acid Sequence
DNA-binding transcriptional activator TdcR Amino Acid Sequence


Size: 72

Fasta

 

>DNA-binding transcriptional activator TdcR E. coli K12. Version NC_000913.3 GI:556503834
MSKFSNFIINKPFSVINNAACHIFSRYLLENKHLFYQYFKISNTCIDHLEQLINVNFFSS
DRTSFCECNRFP
              
                            

Download fasta file
RegulonDB