RegulonDB RegulonDB 10.9: Amino acid Sequence
methyl-accepting chemotaxis protein Trg Amino Acid Sequence


Size: 546

Fasta

 

>methyl-accepting chemotaxis protein Trg E. coli K12. Version NC_000913.3 GI:556503834
MNTTPSQRLGFLHHIRLVPLFACILGGILVLFALSSALAGYFLWQADRDQRDVTAEIEIR
TGLANSSDFLRSARINMIQAGAASRIAEMEAMKRNIAQAESEIKQSQQGYRAYQNRPVKT
PADEALDTELNQRFQAYITGMQPMLKYAKNGMFEAIINHESEQIRPLDNAYTDILNKAVK
IRSTRANQLAELAHQRTRLGGMFMIGAFVLALVMTLITFMVLRRIVIRPLQHAAQRIEKI
ASGDLTMNDEPAGRNEIGRLSRHLQQMQHSLGMTVGTVRQGAEEIYRGTSEISAGNADLS
SRTEEQAAAIEQTAASMEQLTATVKQNADNAHHASKLAQEASIKASDGGQTVSGVVKTMG
AISTSSKKISEITAVINSIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRTLASRSAQ
AAKEIEGLISESVRLIDLGSDEVATAGKTMSTIVDAVASVTHIMQEIAAASDEQSRGITQ
VSQAISEMDKVTQQNASLVEEASAAAVSLEEQAARLTEAVDVFRLHKHSVSAEPRGAGEP
VSFATV
              
                            

Download fasta file
RegulonDB