RegulonDB RegulonDB 10.9: Amino acid Sequence
Rac prophage; K+ transporter TrkG Amino Acid Sequence


Size: 485

Fasta

 

>Rac prophage; K+ transporter TrkG E. coli K12. Version NC_000913.3 GI:556503834
MNTSHVRVVTHMCGFLVWLYSLSMLPPMVVALFYKEKSLFVFFITFVIFFCIGGGAWYTT
KKSGIQLRTRDGFIIIVMFWILFSVISAFPLWIDSELNLTFIDALFEGVSGITTTGATVI
DDVSSLPRAYLYYRSQLNFIGGLGVIVLAVAVLPLLGIGGAKLYQSEMPGPFKDDKLTPR
LADTSRTLWITYSLLGIACIVCYRLAGMPLFDAICHGISTVSLGGFSTHSESIGYFNNYL
VELVAGSFSLLSAFNFTLWYIVISRKTIKPLIRDIELRFFLLIALGVIIVTSFQVWHIGM
YDLHGSFIHSFFLASSMLTDNGLATQDYASWPTHTIVFLLLSSFFGGCIGSTCGGIKSLR
FLILFKQSKHEINQLSHPRALLSVNVGGKIVTDRVMRSVWSFFFLYTLFTVFFILVLNGM
GYDFLTSFATVAACINNMGLGFGATASSFGVLNDIAKCLMCIAMILGRLEIYPVIILFSG
FFWRS
              
                            

Download fasta file
RegulonDB