RegulonDB RegulonDB 10.9: Amino acid Sequence
thioredoxin reductase Amino Acid Sequence


Size: 321

Fasta

 

>thioredoxin reductase E. coli K12. Version NC_000913.3 GI:556503834
MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDL
TGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYL
GLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDG
FRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGL
FVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSA
GTGCMAALDAERYLDGLADAK
              
                            

Download fasta file
RegulonDB