RegulonDB RegulonDB 10.9: Amino acid Sequence
protein chain elongation factor EF-Ts Amino Acid Sequence


Size: 283

Fasta

 

>protein chain elongation factor EF-Ts E. coli K12. Version NC_000913.3 GI:556503834
MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADG
VIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFEEERV
ALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADEELVKHIAMHVAASKPEF
IKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSK
TVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSKQS
              
                            

Download fasta file
RegulonDB