RegulonDB RegulonDB 10.9: Amino acid Sequence
fused chorismate mutase/prephenate dehydrogenase Amino Acid Sequence


Size: 373

Fasta

 

>fused chorismate mutase/prephenate dehydrogenase E. coli K12. Version NC_000913.3 GI:556503834
MVAELTALRDQIDEVDKALLNLLAKRLELVAEVGEVKSRFGLPIYVPEREASMLASRRAE
AEALGVPPDLIEDVLRRVMRESYSSENDKGFKTLCPSLRPVVIVGGGGQMGRLFEKMLTL
SGYQVRILEQHDWDRAADIVADAGMVIVSVPIHVTEQVIGKLPPLPKDCILVDLASVKNG
PLQAMLVAHDGPVLGLHPMFGPDSGSLAKQVVVWCDGRKPEAYQWFLEQIQVWGARLHRI
SAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALSSPIYRLELAMVGRLFAQDP
QLYADIIMSSERNLALIKRYYKRFGEAIELLEQGDKQAFIDSFRKVEHWFGDYAQRFQSE
SRVLLRQANDNRQ
              
                            

Download fasta file
RegulonDB