RegulonDB RegulonDB 11.1: Amino acid Sequence
sn-glycerol 3-phosphate ABC transporter membrane subunit UgpE Amino Acid Sequence


Size: 281

Fasta

 

>sn-glycerol 3-phosphate ABC transporter membrane subunit UgpE E. coli K12. Version NC_000913.3 GI:556503834
MIENRPWLTIFSHTMLILGIAVILFPLYVAFVAATLDKQAVYAAPMTLIPGTHLLENIHN
IWVNGVGTNSAPFWRMLLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRNLFFWMIFIT
LMLPVEVRIFPTVEVIANLQMLDSYAGLTLPLMASATATFLFRQFFMTLPDELVEAARID
GASPMRFFCDIVFPLSKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIAT
GEGTTEWNSVMVAMLLTLIPPVVIVLVMQRAFVRGLVDSEK
              
                            

Download fasta file
RegulonDB