RegulonDB RegulonDB 10.10: Amino acid Sequence
inner membrane protein sensing glucose-6-phosphate Amino Acid Sequence


Size: 439

Fasta

 

>inner membrane protein sensing glucose-6-phosphate E. coli K12. Version NC_000913.3 GI:556503834
MLPFLKAPADAPLMTDKYEIDARYRYWRRHILLTIWLGYALFYFTRKSFNAAVPEILANG
VLSRSDIGLLATLFYITYGVSKFVSGIVSDRSNARYFMGIGLIATGIINILFGFSTSLWA
FAVLWVLNAFFQGWGSPVCARLLTAWYSRTERGGWWALWNTAHNVGGALIPIVMAAAALH
YGWRAGMMIAGCMAIVVGIFLCWRLRDRPQALGLPAVGEWRHDALEIAQQQEGAGLTRKE
ILTKYVLLNPYIWLLSFCYVLVYVVRAAINDWGNLYMSETLGVDLVTANTAVTMFELGGF
IGALVAGWGSDKLFNGNRGPMNLIFAAGILLSVGSLWLMPFASYVMQATCFFTIGFFVFG
PQMLIGMAAAECSHKEAAGAATGFVGLFAYLGASLAGWPLAKVLDTWHWSGFFVVISIAA
GISALLLLPFLNAQTPREA
              
                            

Download fasta file
RegulonDB