RegulonDB RegulonDB 10.10: Amino acid Sequence
uracil-DNA glycosylase Amino Acid Sequence


Size: 229

Fasta

 

>uracil-DNA glycosylase E. coli K12. Version NC_000913.3 GI:556503834
MANELTWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVI
LGQDPYHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVL
LLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRH
HVLKAPHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDWMPVLPAESE
              
                            

Download fasta file
RegulonDB