RegulonDB RegulonDB 10.9: Amino acid Sequence
16S rRNA m4C1402 methyltransferase Amino Acid Sequence


Size: 313

Fasta

 

>16S rRNA m4C1402 methyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MMENYKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQLGEEGRLLAIDRDPQA
IAVAKTIDDPRFSIIHGPFSALGEYVAERDLIGKIDGILLDLGVSSPQLDDAERGFSFMR
DGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTYGEERFAKRIARAIVERNREQPMTRT
KELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQALKSSLNVLAPGGRLSIIS
FHSLEDRIVKRFMRENSRGPQVPAGLPMTEEQLKKLGGRQLRALGKLMPGEEEVAENPRA
RSSVLRIAERTNA
              
                            

Download fasta file
RegulonDB