RegulonDB RegulonDB 10.10: Amino acid Sequence
cell division protein FtsL Amino Acid Sequence


Size: 121

Fasta

 

>cell division protein FtsL E. coli K12. Version NC_000913.3 GI:556503834
MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFICIILTAVTVVTTAHHT
RLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEKLQMQHVDPSQENIVVQ
K
              
                            

Download fasta file
RegulonDB