RegulonDB RegulonDB 11.1: Amino acid Sequence
exodeoxyribonuclease VII subunit XseB Amino Acid Sequence


Size: 80

Fasta

 

>exodeoxyribonuclease VII subunit XseB E. coli K12. Version NC_000913.3 GI:556503834
MPKKNEAPASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAEQRV
QILLSDNEDASLTPFTPDNE
              
                            

Download fasta file
RegulonDB