RegulonDB RegulonDB 10.9: Amino acid Sequence
proofreading thioesterase in enterobactin biosynthesis Amino Acid Sequence


Size: 137

Fasta

 

>proofreading thioesterase in enterobactin biosynthesis E. coli K12. Version NC_000913.3 GI:556503834
MIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDTRTHQPFGLLHGGASAA
LAETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQPLHLGRQNQSWEIVVFD
EQGRRCCTCRLGTAVLG
              
                            

Download fasta file
RegulonDB