RegulonDB RegulonDB 10.9: Amino acid Sequence
esterase/thioesterase Amino Acid Sequence


Size: 134

Fasta

 

>esterase/thioesterase E. coli K12. Version NC_000913.3 GI:556503834
MNTTLFRWPVRVYYEDTDAGGVVYHASYVAFYERARTEMLRHHHFSQQALMAERVAFVVR
KMTVEYYAPARLDDMLEIQTEITSMRGTSLVFTQRIVNAENTLLNEAEVLVVCVDPLKMK
PRALPKSIVAEFKQ
              
                            

Download fasta file
RegulonDB