RegulonDB RegulonDB 10.9: Amino acid Sequence
DNA replication inhibitor CspD Amino Acid Sequence


Size: 74

Fasta

 

>DNA replication inhibitor E. coli K12. Version NC_000913.3 GI:556503834
MEKGTVKWFNNAKGFGFICPEGGGEDIFAHYSTIQMDGYRTLKAGQSVQFDVHQGPKGNH
ASVIVPVEVEAAVA
              
                            

Download fasta file
RegulonDB