RegulonDB RegulonDB 10.9: Amino acid Sequence
leucyl/phenylalanyl-tRNA—protein transferase Amino Acid Sequence


Size: 234

Fasta

 

>leucyl/phenylalanyl-tRNA—protein transferase E. coli K12. Version NC_000913.3 GI:556503834
MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWS
PDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAY
HRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGH
GGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE
              
                            

Download fasta file
RegulonDB