RegulonDB RegulonDB 11.0: Amino acid Sequence
DUF177 domain-containing protein YceD Amino Acid Sequence


Size: 173

Fasta

 

>DUF177 domain-containing protein YceD E. coli K12. Version NC_000913.3 GI:556503834
MQKVKLPLTLDPVRTAQKRLDYQGIYTPDQVERVAESVVSVDSDVECSMSFAIDNQRLAV
LNGDAKVTVTLECQRCGKPFTHQVYTTYCFSPVRSDEQAEALPEAYEPIEVNEFGEIDLL
AMVEDEIILALPVVPVHDSEHCEVSEADMVFGELPEEAQKPNPFAVLASLKRK
              
                            

Download fasta file
RegulonDB