RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF892 domain-containing protein YciF Amino Acid Sequence


Size: 166

Fasta

 

>DUF892 domain-containing protein YciF E. coli K12. Version NC_000913.3 GI:556503834
MNMKTIEDVFIHLLSDTYSAEKQLTRALAKLARATSNEKLSQAFHAHLEETHGQIERIDQ
VVESESNLKIKRMKCVAMEGLIEEANEVIESTEKNEVRDAALIAAAQKVEHYEIASYGTL
ATLAEQLGYRKAAKLLKETLEEEKATDIKLTDLAINNVNKKAENKA
              
                            

Download fasta file
RegulonDB