RegulonDB RegulonDB 10.9: Amino acid Sequence
stress-induced bacterial acidophilic repeat motifs-containing protein YciG Amino Acid Sequence


Size: 59

Fasta

 

>stress-induced bacterial acidophilic repeat motifs-containing protein YciG E. coli K12. Version NC_000913.3 GI:556503834
MAEHRGGSGNFAEDREKASDAGRKGGQHSGGNFKNDPQRASEAGKKGGQQSGGNKSGKS
              
                            

Download fasta file
RegulonDB