RegulonDB RegulonDB 10.8: Amino acid Sequence
NlpC/P60 family lipoprotein NlpC Amino Acid Sequence


Size: 154

Fasta

 

>NlpC/P60 family lipoprotein NlpC E. coli K12. Version NC_000913.3 GI:556503834
MRFCLILITALLLAGCSHHKAPPPNARLSDSITVIAGLNDQLQSWHGTPYRYGGMTRRGV
DCSGFVVVTMRDRFDLQLPRETKQQASIGTQIDKDELLPGDLVFFKTGSGQNGLHVGIYD
TNNQFIHASTSKGVMRSSLDNVYWQKNFWQARRI
              
                            

Download fasta file
RegulonDB