RegulonDB RegulonDB 10.10: Amino acid Sequence
putative oxidoreductase YdjA Amino Acid Sequence


Size: 183

Fasta

 

>putative oxidoreductase E. coli K12. Version NC_000913.3 GI:556503834
MDALELLINRRSASRLAEPAPTGEQLQNILRAGMRAPDHKSMQPWHFFVIEGEGRERFSA
VLEQGAIAAGSDDKAIDKARNAPFRAPLIITVVAKCEENHKVPRWEQEMSAGCAVMAMQM
AAVAQGFGGIWRSGALTESPVVREAFGCREQDKIVGFLYLGTPQLKASTSINVPDPTPFV
TYF
              
                            

Download fasta file
RegulonDB