RegulonDB RegulonDB 10.9: Amino acid Sequence
putative papain-like amidase YebB Amino Acid Sequence


Size: 200

Fasta

 

>putative papain-like amidase YebB E. coli K12. Version NC_000913.3 GI:556503834
MNINYPAEYEIGDIVFTCIGAALFGQISAASNCWSNHVGIIIGHNGEDFLVAESRVPLST
ITTLSRFIKRSSNQRYAIKRLDAGLTERQKQRIVEQVPSRLRKLYHTGFKYESSRQFCSK
FVFDIYKEALCIPVGEIETFGELLNSNPNAKLTFWKFWFLGSIPWERKTVTPASLWHHPG
LVLIHAEGVETPQPELTEAV
              
                            

Download fasta file
RegulonDB