RegulonDB RegulonDB 10.8: Amino acid Sequence
DUF2138 domain-containing protein YfaA Amino Acid Sequence


Size: 562

Fasta

 

>DUF2138 domain-containing protein YfaA E. coli K12. Version NC_000913.3 GI:556503834
MSGEKKAKGWRFYGLVGFGAIALLSAGVWALQYAGSGPEKTLSPLVVHNNLQIDLNEPDL
FLDSDSLSQLPKDLLTIPFLHDVLSEDFVFYYQNHADRLGIEGSIRRIVYEHDLTLKDKL
FSSLLDQPAQAALWHDKQGHLSHYMVLIQRSGLSKLLEPLLFAATSDSQLSKTEISSIKI
NSETVPVYQLRYNGNNALMFATYQDKMLVFSSTDMLFKDDQQDTEATAIAGDLLSGKKRW
QASFGLEERTAEKTPVRQRIVVSARWLGFGYQRLMPSFAGVRFEMGNDGWHSFVALNDES
ASVDASFDFTPVWNSMPAGASFCVAVPYSHGIAEEMLSHISQENDKLNGALDGAAGLCWY
EDSKLQTPLFVGQFDGTAEQAQLPGKLFTQNIGAHESKAPEGVLPVSQTQQGEAQIWRRE
VSSRYGQYPKAQAAQPDQLMSDYFFRVSLAMQNKTLLFSLDDTLVNNALQTLNKTRPAMV
DVIPTDGIVPLYINPQGIAKLLRNETLTSLPKNLEPVFYNAAQTLLMPKLDALSQQPRYV
MKLAQMEPGAAWQWLPITWQPL
              
                            

Download fasta file
RegulonDB